RegulonDB RegulonDB 10.8: Amino acid Sequence
thiamine monophosphate kinase Amino Acid Sequence


Size: 325

Fasta

 

>thiamine monophosphate kinase E. coli K12. Version NC_000913.3 GI:556503834
MACGEFSLIARYFDRVRSSRLDVELGIGDDCALLNIPEKQTLAISTDTLVAGNHFLPDID
PADLAYKALAVNLSDLAAMGADPAWLTLALTLPDVDEAWLESFSDSLFDLLNYYDMQLIG
GDTTRGPLSMTLGIHGFVPMGRALTRSGAKPGDWIYVTGTPGDSAAGLAILQNRLQVADA
KDADYLIKRHLRPSPRILQGQALRDLANSAIDLSDGLISDLGHIVKASDCGARIDLALLP
FSDALSRHVEPEQALRWALSGGEDYELCFTVPELNRGALDVALGHLGVPFTCIGQMTADI
EGLCFIRDGEPVTLDWKGYDHFATP
              
                            

Download fasta file
RegulonDB