RegulonDB RegulonDB 10.8: Amino acid Sequence
DUF1116 domain-containing protein YlbE Amino Acid Sequence


Size: 419

Fasta

 

>DUF1116 domain-containing protein YlbE E. coli K12. Version NC_000913.3 GI:556503834
MFTSVAQANAAVIEQIRRARPHWLDVQPASSLISELNEGKTLLHAGPPMRWQEMTGPMKG
ACVGACLFEGWAKDEAQALAILEQGEVNFIPCHHVNAVGPMGGITSASMPMLVVENVTDG
NRAYCNLNEGIGKVMRFGAYGEDVLTRHRWMRDVLMPVLSAALGRMERGIDLTAMMAQGI
TMGDEFHQRNIASSALLMRALAPQIARLDHDKQHIAEVMDFLSVTDQFFLNLAMAYCKAA
MDAGAMIRAGSIVTAMTRNGNMFGIRVSGLGERWFTAPVNTPQGLFFTGFSQEQANPDMG
DSAITETFGIGGAAMIAAPGVTRFVGAGGMEAARAVSEEMAEIYLERNMQLQIPSWDFQG
ACLGLDIRRVVETGITPLINTGIAHKEAGIGQIGAGTVRAPLACFEQALEALAESMGIG
              
                            

Download fasta file
RegulonDB