RegulonDB RegulonDB 10.8: Amino acid Sequence
citrate lyase α subunit Amino Acid Sequence


Size: 510

Fasta

 

>citrate lyase α subunit E. coli K12. Version NC_000913.3 GI:556503834
MTQKIEQSQRQERVAAWNRRAECDLAAFQNSPKQTYQAEKARDRKLCANLEEAIRRSGLQ
DGMTVSFHHAFRGGDLTVNMVMDVIAKMGFKNLTLASSSLSDCHAPLVEHIRQGVVTRIY
TSGLRGPLAEEISRGLLAEPVQIHSHGGRVHLVQSGELNIDVAFLGVPSCDEFGNANGYT
GKACCGSLGYAIVDADNAKQVVMLTEELLPYPHNPASIEQDQVDLIVKVDRVGDAAKIGA
GATRMTTNPRELLIARSAADVIVNSGYFKEGFSMQTGTGGASLAVTRFLEDKMRSRDIRA
DFALGGITATMVDLHEKGLIRKLLDVQSFDSHAAQSLARNPNHIEISANQYANWGSKGAS
VDRLDVVVLSALEIDTQFNVNVLTGSDGVLRGASGGHCDTAIASALSIIVAPLVRGRIPT
LVDNVLTCITPGSSVDILVTDHGIAVNPARPELAERLQEAGIKVVSIEWLRERARLLTGE
PQPIEFTDRVVAVVRYRDGSVIDVVHQVKE
              
                            

Download fasta file
RegulonDB