RegulonDB RegulonDB 10.9: Amino acid Sequence
citrate lyase β subunit Amino Acid Sequence


Size: 302

Fasta

 

>citrate lyase β subunit E. coli K12. Version NC_000913.3 GI:556503834
MISASLQQRKTRTRRSMLFVPGANAAMVSNSFIYPADALMFDLEDSVALREKDTARRMVY
HALQHPLYRDIETIVRVNALDSEWGVNDLEAVVRGGADVVRLPKTDTAQDVLDIEKEILR
IEKACGREPGSTGLLAAIESPLGITRAVEIAHASERLIGIALGAEDYVRNLRTERSPEGT
ELLFARCSILQAARSAGIQAFDTVYSDANNEAGFLQEAAHIKQLGFDGKSLINPRQIDLL
HNLYAPTQKEVDHARRVVEAAEAAAREGLGVVSLNGKMVDGPVIDRARLVLSRAELSGIR
EE
              
                            

Download fasta file
RegulonDB