RegulonDB RegulonDB 10.8: Amino acid Sequence
chaperone protein HscC Amino Acid Sequence


Size: 556

Fasta

 

>chaperone protein HscC E. coli K12. Version NC_000913.3 GI:556503834
MDNAELAIGIDLGTTNSLIAVWKDGAAQLIPNKFGEYLTPSIISMDENNHILVGKPAVSR
RTSHPDKTAALFKRAMGSNTNWRLGSDTFNAPELSSLVLRSLKEDAEEFLQRPIKDVVIS
VPAYFSDEQRKHTRLAAELAGLNAVRLINEPTAAAMAYGLHTQQNTRSLVFDLGGGTFDV
TVLEYATPVIEVHASAGDNFLGGEDFTHMLVDEVLKRADVARTTLNESELAALYACVEAA
KCSNQSPLHIRWQYQEETRECEFYENELEDLWLPLLNRLRVPIEQALRDARLKPSQIDSL
VLVGGASQMPLVQRIAVRLFGKLPYQSYDPSTIVALGAAIQAACRLRSEDIEEVILTDIC
PYSLGVEVNRQGVSGIFSPIIERNTTVPVSRVETYSTMHPEQDSITVNVYQGENHKVKNN
ILVESFDVPLKKTGAYQSIDIRFSYDINGLLEVDVLLEDGSVKSRVINHSPVTLSAQQIE
ESRTRLSALKIYPRDMLINRTFKAKLEELWARALGDEREEIGRVITDFDAALQSNDMARV
DEVRRRASDYLAIEIP
              
                            

Download fasta file
RegulonDB