RegulonDB RegulonDB 11.0: Amino acid Sequence
DNA-binding transcriptional dual regulator ModE Amino Acid Sequence


Size: 262

Fasta

 

>DNA-binding transcriptional dual regulator ModE E. coli K12. Version NC_000913.3 GI:556503834
MQAEILLTLKLQQKLFADPRRISLLKHIALSGSISQGAKDAGISYKSAWDAINEMNQLSE
HILVERATGGKGGGGAVLTRYGQRLIQLYDLLAQIQQKAFDVLSDDDALPLNSLLAAISR
FSLQTSARNQWFGTITARDHDDVQQHVDVLLADGKTRLKVAITAQSGARLGLDEGKEVLI
LLKAPWVGITQDEAVAQNADNQLPGIISHIERGAEQCEVLMALPDGQTLCATVPVNEATS
LQQGQNVTAYFNADSVIIATLC
              
                            

Download fasta file
RegulonDB