RegulonDB RegulonDB 10.8: Amino acid Sequence
putative inner membrane protein Amino Acid Sequence


Size: 125

Fasta

 

>putative inner membrane protein E. coli K12. Version NC_000913.3 GI:556503834
MKHKQRWAGAICCFVLFIVVCLFLATHMKGAFRAAGHPEIGLLFFILPGAVASFFSQRRE
VLKPLFGAMLAAPCSMLIMRLFFSPTRSFWQELAWLLSAVFWCALGALCFLFISSLFKPQ
HRKNQ
              
                            

Download fasta file
RegulonDB