RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF3828 domain-containing lipoprotein YbjP Amino Acid Sequence


Size: 171

Fasta

 

>DUF3828 domain-containing lipoprotein YbjP E. coli K12. Version NC_000913.3 GI:556503834
MRYSKLTMLIPCALLLSACTTVTPAYKDNGTRSGPCVEGGPDNVAQQFYDYRILHRSNDI
TALRPYLSDKLATLLSDASRDNNHRELLTNDPFSSRTTLPDSAHVASASTIPNRDARNIP
LRVDLKQGDQGWQDEVLMIQEGQCWVIDDVRYLGGSVHATAGTLRQSIENR
              
                            

Download fasta file
RegulonDB