RegulonDB RegulonDB 11.0: Amino acid Sequence
putative NAD(P)-binding protein YbjT Amino Acid Sequence


Size: 476

Fasta

 

>putative NAD(P)-dependent oxidoreductase YbjT E. coli K12. Version NC_000913.3 GI:556503834
MPQRILVLGASGYIGQHLVRTLSQQGHQILAAARHVDRLAKLQLANVSCHKVDLSWPDNL
PALLQDIDTVYFLVHSMGEGGDFIAQERQVALNVRDALREVPVKQLIFLSSLQAPPHEQS
DHLRARQATADILREANVPVTELRAGIIVGAGSAAFEVMRDMVYNLPVLTPPRWVRSRTT
PIALENLLHYLVALLDHPASEHRIFEAAGPEVLSYQQQFEHFMAVSGKRRWLIPIPLPTR
WISVWFLNVITSVPPTTARALIQGLKHDLLADDTALRALIPQRLIAFDDAVRSTLKEEEK
LVNSSDWGYDAQAFARWRPEYGYFAKQAGFTVKTSASLAALWQVVNQIGGKERYFFGNIL
WQTRALMDRAIGHKLAKGRPEREYLQTGDAVDSWKVIVVEPEKQLTLLFGMKAPGLGRLC
FSLEDKGDYRTIDVRAFWHPHGMPGLFYWLLMIPAHLFIFRGMAKQIARLAEQSTD
              
                            

Download fasta file
RegulonDB