RegulonDB RegulonDB 10.8: Amino acid Sequence
DUF2813 domain-containing protein YbjD Amino Acid Sequence


Size: 552

Fasta

 

>DUF2813 domain-containing protein YbjD E. coli K12. Version NC_000913.3 GI:556503834
MILERVEIVGFRGINRLSLMLEQNNVLIGENAWGKSSLLDALTLLLSPESDLYHFERDDF
WFPPGDINGREHHLHIILTFRESLPGRHRVRRYRPLEACWTPCTDGYHRIFYRLEGESAE
DGSVMTLRSFLDKDGHPIDVEDINDQARHLVRLMPVLRLRDARFMRRIRNGTVPNVPNVE
VTARQLDFLARELSSHPQNLSDGQIRQGLSAMVQLLEHYFSEQGAGQARYRLMRRRASNE
QRSWRYLDIINRMIDRPGGRSYRVILLGLFATLLQAKGTLRLDKDARPLLLIEDPETRLH
PIMLSVAWHLLNLLPLQRIATTNSGELLSLTPVEHVCRLVRESSRVAAWRLGPSGLSTED
SRRISFHIRFNRPSSLFARCWLLVEGETETWVINELARQCGHHFDAEGIKVIEFAQSGLK
PLVKFARRMGIEWHVLVDGDEAGKKYAATVRSLLNNDREAEREHLTALPALDMEHFMYRQ
GFSDVFHRMAQIPENVPMNLRKIISKAIHRSSKPDLAIEVAMEAGRRGVDSVPTLLKKMF
SRVLWLARGRAD
              
                            

Download fasta file
RegulonDB