RegulonDB RegulonDB 10.8: Amino acid Sequence
outer membrane lipoprotein carrier protein Amino Acid Sequence


Size: 203

Fasta

 

>outer membrane lipoprotein carrier protein E. coli K12. Version NC_000913.3 GI:556503834
MKKIAITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDL
WVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSS
DWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQN
GAVDAAKFTFTPPQGVTVDDQRK
              
                            

Download fasta file
RegulonDB