RegulonDB RegulonDB 10.10: Amino acid Sequence
ribosomal protein S12 methylthiotransferase accessory factor YcaO Amino Acid Sequence


Size: 586

Fasta

 

>ribosomal protein S12 methylthiotransferase accessory factor YcaO E. coli K12. Version NC_000913.3 GI:556503834
MTQTFIPGKDAALEDSIARFQQKLSDLGFQIEEASWLNPVPNVWSVHIRDKECALCFTNG
KGATKKAALASALGEYFERLSTNYFFADFWLGETIANGPFVHYPNEKWFPLTENDDVPEG
LLDDRLRAFYDPENELTGSMLIDLQSGNEDRGICGLPFTRQSDNQTVYIPMNIIGNLYVS
NGMSAGNTRNEARVQGLSEVFERYVKNRIIAESISLPEIPADVLARYPAVVEAIETLEAE
GFPIFAYDGSLGGQYPVICVVLFNPANGTCFASFGAHPDFGVALERTVTELLQGRGLKDL
DVFTPPTFDDEEVAEHTNLETHFIDSSGLISWDLFKQDADYPFVDWNFSGTTEEEFATLM
AIFNKEDKEVYIADYEHLGVYACRIIVPGMSDIYPAEDLWLANNSMGSHLRETILSLPGS
EWEKEDYLNLIEQLDEEGFDDFTRVRELLGLATGSDNGWYTLRIGELKAMLALAGGDLEQ
ALVWTEWTMEFNSSVFSPERANYYRCLQTLLLLAQEEDRQPLQYLNAFVRMYGADAVEAA
SAAMSGEAAFYGLQPVDSDLHAFAAHQSLLKAYEKLQRAKAAFWAK
              
                            

Download fasta file
RegulonDB