RegulonDB RegulonDB 10.8: Amino acid Sequence
aliphatic sulfonate ABC transporter periplasmic binding protein Amino Acid Sequence


Size: 319

Fasta

 

>aliphatic sulfonate ABC transporter periplasmic binding protein E. coli K12. Version NC_000913.3 GI:556503834
MRNIIKLALAGLLSVSTFAVAAESSPEALRIGYQKGSIGMVLAKSHQLLEKRYPESKISW
VEFPAGPQMLEALNVGSIDLGSTGDIPPIFAQAAGADLVYVGVEPPKPKAEVILVAENSP
IKTVADLKGHKVAFQKGSSSHNLLLRALRQAGLKFTDIQPTYLTPADARAAFQQGNVDAW
AIWDPYYSAALLQGGVRVLKDGTDLNQTGSFYLAARPYAEKNGAFIQGVLATFSEADALT
RSQREQSIALLAKTMGLPAPVIASYLDHRPPTTIKPVNAEVAALQQQTADLFYENRLVPK
KVDIRQRIWQPTQLEGKQL
              
                            

Download fasta file
RegulonDB