RegulonDB RegulonDB 10.8: Amino acid Sequence
NADPH-dependent FMN reductase Amino Acid Sequence


Size: 191

Fasta

 

>NADPH-dependent FMN reductase E. coli K12. Version NC_000913.3 GI:556503834
MRVITLAGSPRFPSRSSSLLEYAREKLNGLDVEVYHWNLQNFAPEDLLYARFDSPALKTF
TEQLQQADGLIVATPVYKAAYSGALKTLLDLLPERALQGKVVLPLATGGTVAHLLAVDYA
LKPVLSALKAQEILHGVFADDSQVIDYHHRPQFTPNLQTRLDTALETFWQALHRRDVQVP
DLLSLRGNAHA
              
                            

Download fasta file
RegulonDB