RegulonDB RegulonDB 10.8: Amino acid Sequence
fused 23S rRNA m2G2445 methyltransferase and 23S rRNA m7G2069 methyltransferase Amino Acid Sequence


Size: 702

Fasta

 

>fused 23S rRNA m2G2445 methyltransferase and 23S rRNA m7G2069 methyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MNSLFASTARGLEELLKTELENLGAVECQVVQGGVHFKGDTRLVYQSLMWSRLASRIMLP
LGECKVYSDLDLYLGVQAINWTEMFNPGATFAVHFSGLNDTIRNSQYGAMKVKDAIVDAF
TRKNLPRPNVDRDAPDIRVNVWLHKETASIALDLSGDGLHLRGYRDRAGIAPIKETLAAA
IVMRSGWQPGTPLLDPMCGSGTLLIEAAMLATDRAPGLHRGRWGFSGWAQHDEAIWQEVK
AEAQTRARKGLAEYSSHFYGSDSDARVIQRARTNARLAGIGELITFEVKDVAQLTNPLPK
GPYGTVLSNPPYGERLDSEPALIALHSLLGRIMKNQFGGWNLSLFSASPDLLSCLQLRAD
KQYKAKNGPLDCVQKNYHVAESTPDSKPAMVAEDYTNRLRKNLKKFEKWARQEGIECYRL
YDADLPEYNVAVDRYADWVVVQEYAPPKTIDAHKARQRLFDIIAATISVLGIAPNKLVLK
TRERQKGKNQYQKLGEKGEFLEVTEYNAHLWVNLTDYLDTGLFLDHRIARRMLGQMSKGK
DFLNLFSYTGSATVHAGLGGARSTTTVDMSRTYLEWAERNLRLNGLTGRAHRLIQADCLA
WLREANEQFDLIFIDPPTFSNSKRMEDAFDVQRDHLALMKDLKRLLRAGGTIMFSNNKRG
FRMDLDGLAKLGLKAQEITQKTLSQDFARNRQIHNCWLITAA
              
                            

Download fasta file
RegulonDB