RegulonDB RegulonDB 10.8: Amino acid Sequence
threonine-rich inner membrane protein GfcA Amino Acid Sequence


Size: 101

Fasta

 

>threonine-rich inner membrane protein GfcA E. coli K12. Version NC_000913.3 GI:556503834
MKHKLSAILMAFMLTTPAAFAAPEATNGTEATTGTTGTTTTTTGATTTATTTGGVAAGAV
GTATVVGVATAVGVATLAVVAANDSGDGGSHNTSTTTSTTR
              
                            

Download fasta file
RegulonDB