RegulonDB RegulonDB 10.10: Amino acid Sequence
inactive ferrous iron permease EfeU Amino Acid Sequence


Size: 275

Fasta

 

>inactive ferrous iron permease EfeU, N-terminal fragment E. coli K12. Version NC_000913.3 GI:556503834
MFVPFLIMLREGLEAALIVSLIASYLKRTQRGRWIV*CGLACCLPLRCAWAWVSSLTKPP
ANFRKKNRNCLKVSWR*SPW*SLPGWFSGCAKCRATSKCNWNRQSIAHCSVEIIMAGRW*
*WSFLPLQGKGWSRSFSCWRHFNKMSGSGRRWVQCSVLLLPWC*ASCSTGAVFASILVHF
LNGPACLFSSSPQGWQLVPFAHFMKPDCGTTFRKSPSI*VRCSQLTRCLAR*WKGFLAIR
KRRASAKSPSGLFISSRRWWHLLCHHAQGRQRLAP
              
                            

Download fasta file
RegulonDB