RegulonDB RegulonDB 10.7: Amino acid Sequence
poly-N-acetyl-D-glucosamine synthase subunit PgaD Amino Acid Sequence


Size: 137

Fasta

 

>poly-N-acetyl-D-glucosamine synthase subunit PgaD E. coli K12. Version NC_000913.3 GI:556503834
MNNLIITTRQSPVRLLVDYVATTILWTLFALFIFLFAMDLLTGYYWQSEARSRLQFYFLL
AVANAVVLIVWALYNKLRFQKQQHHAAYQYTPQEYAESLAIPDELYQQLQKSHRMSVHFT
SQGQIKMVVSEKALVRA
              
                            

Download fasta file
RegulonDB