RegulonDB RegulonDB 10.10: Amino acid Sequence
curli assembly component CsgE Amino Acid Sequence


Size: 129

Fasta

 

>curli transport specificity factor E. coli K12. Version NC_000913.3 GI:556503834
MKRYLRWIVAAEFLFAAGNLHAVEVEVPGLLTDHTVSSIGHDFYRAFSDKWESDYTGNLT
INERPSARWGSWITITVNQDVIFQTFLFPLKRDFEKTVVFALIQTEEALNRRQINQALLS
TGDLAHDEF
              
                            

Download fasta file
RegulonDB