RegulonDB RegulonDB 10.10: Amino acid Sequence
DNA-binding transcriptional dual regulator CsgD Amino Acid Sequence


Size: 216

Fasta

 

>DNA-binding transcriptional dual regulator CsgD E. coli K12. Version NC_000913.3 GI:556503834
MFNEVHSIHGHTLLLITKSSLQATALLQHLKQSLAITGKLHNIQRSLDDISSGSIILLDM
MEADKKLIHYWQDTLSRKNNNIKILLLNTPEDYPYRDIENWPHINGVFYSMEDQERVVNG
LQGVLRGECYFTQKLASYLITHSGNYRYNSTESALLTHREKEILNKLRIGASNNEIARSL
FISENTVKTHLYNLFKKIAVKNRTQAVSWANDNLRR
              
                            

Download fasta file
RegulonDB