RegulonDB RegulonDB 10.10: Amino acid Sequence
curlin, minor subunit Amino Acid Sequence


Size: 151

Fasta

 

>curlin, minor subunit E. coli K12. Version NC_000913.3 GI:556503834
MKNKLLFMMLTILGAPGIAAAAGYDLANSEYNFAVNELSKSSFNQAAIIGQAGTNNSAQL
RQGGSKLLAVVAQEGSSNRAKIDQTGDYNLAYIDQAGSANDASISQGAYGNTAMIIQKGS
GNKANITQYGTQKTAIVVQRQSQMAIRVTQR
              
                            

Download fasta file
RegulonDB