RegulonDB RegulonDB 10.8: Amino acid Sequence
lytic murein transglycosylase E Amino Acid Sequence


Size: 203

Fasta

 

>lytic murein transglycosylase E E. coli K12. Version NC_000913.3 GI:556503834
MKLRWFAFLIVLLAGCSSKHDYTNPPWNAKVPVQRAMQWMPISQKAGAAWGVDPQLITAI
IAIESGGNPNAVSKSNAIGLMQLKASTSGRDVYRRMGWSGEPTTSELKNPERNISMGAAY
LNILETGPLAGIEDPKVLQYALVVSYANGAGALLRTFSSDRKKAISKINDLDADEFLEHV
ARNHPAPQAPRYIYKLEQALDAM
              
                            

Download fasta file
RegulonDB