RegulonDB RegulonDB 10.8: Amino acid Sequence
RNA/ssDNA 5'→3' exonuclease Amino Acid Sequence


Size: 293

Fasta

 

>RNA/ssDNA 5'→3' exonuclease E. coli K12. Version NC_000913.3 GI:556503834
MSDTNYAVIYDLHSHTTASDGCLTPEALVHRAVEMRVGTLAITDHDTTAAIAPAREEISR
SGLALNLIPGVEISTVWENHEIHIVGLNIDITHPLMCEFLAQQTERRNQRAQLIAERLEK
AQIPGALEGAQRLAQGGAVTRGHFARFLVECGKASSMADVFKKYLARGKTGYVPPQWCTI
EQAIDVIHHSGGKAVLAHPGRYNLSAKWLKRLVAHFAEHHGDAMEVAQCQQSPNERTQLA
ALARQHHLWASQGSDFHQPCPWIELGRKLWLPAGVEGVWQLWEQPQNTTEREL
              
                            

Download fasta file
RegulonDB