RegulonDB RegulonDB 10.8: Amino acid Sequence
putrescine:H+ symporter PuuP Amino Acid Sequence


Size: 461

Fasta

 

>putrescine:H+ symporter PuuP E. coli K12. Version NC_000913.3 GI:556503834
MAINSPLNIAAQPGKTRLRKSLKLWQVVMMGLAYLTPMTVFDTFGIVSGISDGHVPASYL
LALAGVLFTAISYGKLVRQFPEAGSAYTYAQKSINPHVGFMVGWSSLLDYLFLPMINVLL
AKIYLSALFPEVPPWVWVVTFVAILTAANLKSVNLVANFNTLFVLVQISIMVVFIFLVVQ
GLHKGEGVGTVWSLQPFISENAHLIPIITGATIVCFSFLGFDAVTTLSEETPDAARVIPK
AIFLTAVYGGVIFIAASFFMQLFFPDISRFKDPDAALPEIALYVGGKLFQSIFLCTTFVN
TLASGLASHASVSRLLYVMGRDNVFPERVFGYVHPKWRTPALNVIMVGIVALSALFFDLV
TATALINFGALVAFTFVNLSVFNHFWRRKGMNKSWKDHFHYLLMPLVGALTVGVLWVNLE
STSLTLGLVWASLGGAYLWYLIRRYRKVPLYDGDRTPVSET
              
                            

Download fasta file
RegulonDB