RegulonDB RegulonDB 10.7: Amino acid Sequence
L-Ala-D/L-Glu epimerase Amino Acid Sequence


Size: 321

Fasta

 

>L-Ala-D/L-Glu epimerase E. coli K12. Version NC_000913.3 GI:556503834
MRTVKVFEEAWPLHTPFVIARGSRSEARVVVVELEEEGIKGTGECTPYPRYGESDASVMA
QIMSVVPQLEKGLTREELQKILPAGAARNALDCALWDLAARRQQQSLADLIGITLPETVI
TAQTVVIGTPDQMANSASTLWQAGAKLLKVKLDNHLISERMVAIRTAVPDATLIVDANES
WRAEGLAARCQLLADLGVAMLEQPLPAQDDAALENFIHPLPICADESCHTRSNLKALKGR
YEMVNIKLDKTGGLTEALALATEARAQGFSLMLGCMLCTSRAISAALPLVPQVSFADLDG
PTWLAVDVEPALQFTTGELHL
              
                            

Download fasta file
RegulonDB