RegulonDB RegulonDB 10.7: Amino acid Sequence
murein tripeptide amidase A Amino Acid Sequence


Size: 242

Fasta

 

>murein tripeptide amidase A E. coli K12. Version NC_000913.3 GI:556503834
MTVTRPRAERGAFPPGTEHYGRSLLGAPLIWFPAPAASRESGLILAGTHGDENSSVVTLS
CALRTLTPSLRRHHVVLCVNPDGCQLGLRANANGVDLNRNFPAANWKEGETVYRWNSAAE
ERDVVLLTGDKPGSEPETQALCQLIHRIQPAWVVSFHDPLACIEDPRHSELGEWLAQAFE
LPLVTSVGYETPGSFGSWCADLNLHCITAEFPPISSDEASEKYLFAMANLLRWHPKDAIR
PS
              
                            

Download fasta file
RegulonDB