RegulonDB RegulonDB 10.8: Amino acid Sequence
Rac prophage; uncharacterized protein YdaG Amino Acid Sequence


Size: 44

Fasta

 

>Rac prophage; uncharacterized protein YdaG E. coli K12. Version NC_000913.3 GI:556503834
MVHYEVVQYLMDCCGITYNQAVQALRSNDWDLWQAEVAIRSNKM
              
                            

Download fasta file
RegulonDB