RegulonDB RegulonDB 10.10: Amino acid Sequence
phenylacetyl-CoA 1,2-epoxidase, structural subunit Amino Acid Sequence


Size: 248

Fasta

 

>phenylacetyl-CoA 1,2-epoxidase, structural subunit E. coli K12. Version NC_000913.3 GI:556503834
MNQLTAYTLRLGDNCLVLSQRLGEWCGHAPELEIDLALANIGLDLLGQARNFLSYAAELA
GEGDEDTLAFTRDERQFSNLLLVEQPNGNFADTIARQYFIDAWHVALFTRLMESRDPQLA
AISAKAIKEARYHLRFSRGWLERLGNGTDVSGQKMQQAINKLWRFTAELFDADEIDIALS
EEGIAVDPRTLRAAWEAEVFAGINEATLNVPQEQAYRTGGKKGLHTEHLGPMLAEMQYLQ
RVLPGQQW
              
                            

Download fasta file
RegulonDB