RegulonDB RegulonDB 10.10: Amino acid Sequence
DNA-binding transcriptional repressor PaaX Amino Acid Sequence


Size: 316

Fasta

 

>DNA-binding transcriptional repressor PaaX E. coli K12. Version NC_000913.3 GI:556503834
MSKLDTFIQHAVNAVPVSGTSLISSLYGDSLSHRGGEIWLGSLAALLEGLGFGERFVRTA
LFRLNKEGWLDVSRIGRRSFYSLSDKGLRLTRRAESKIYRAEQPAWDGKWLLLLSEGLDK
STLADVKKQLIWQGFGALAPSLMASPSQKLADVQTLLHEAGVADNVICFEAQIPLALSRA
ALRARVEECWHLTEQNAMYETFIQSFRPLVPLLKEAADELTPERAFHIQLLLIHFYRRVV
LKDPLLPEELLPAHWAGHTARQLCINIYQRVAPAALAFVSEKGETSVGELPAPGSLYFQR
FGGLNIEQEALCQFIR
              
                            

Download fasta file
RegulonDB