RegulonDB RegulonDB 11.1: Amino acid Sequence
DUF2554 domain-containing protein YncJ Amino Acid Sequence


Size: 76

Fasta

 

>protein YncJ E. coli K12. Version NC_000913.3 GI:556503834
MFTKALSVVLLTCALFSGQLMAGHKGHEFVWVKNVDHQLRHEADSDELRAVAEESAEGLR
EHFYWQKSRKPEAGQR
              
                            

Download fasta file
RegulonDB