RegulonDB RegulonDB 10.8: Amino acid Sequence
biofilm-dependent modulation protein Amino Acid Sequence


Size: 71

Fasta

 

>biofilm-dependent modulation protein E. coli K12. Version NC_000913.3 GI:556503834
MFTYYQAENSTAEPALVNAIEQGLRAQHGVVTEDDILMELTKWVEASDNDILSDIYQQTI
NYVVSGQHPTL
              
                            

Download fasta file
RegulonDB