RegulonDB RegulonDB 10.7: Amino acid Sequence
putative D,D-dipeptide ABC transporter ATP-binding subunit DdpF Amino Acid Sequence


Size: 308

Fasta

 

>putative D,D-dipeptide ABC transporter ATP-binding subunit DdpF E. coli K12. Version NC_000913.3 GI:556503834
MSDTLLTLRDVHINFPARKNWLGKTTEHVHAINGIDLQIRRGETLGIVGESGCGKSTLAQ
LLMGMLQPSHGQYIRSGSQRIMQMVFQDPLSSLNPRLPVWRIITEPLWIAKRSSEQQRRA
LAEELAVQVGIRPEYLDRLPHAFSGGQRQRIAIARALSSQPDVIVLDEPTSALDISVQAQ
ILNLLVTLQENHGLTYVLISHNVSVIRHMSDRVAVMYLGQIVELGDAQQVLTAPAHPYTR
LLLDSLPAIDKPLEEEWALRKTDLPGNRTLPQGCFFYERCPLATHGCEVRQSLAIREDGR
ELRCWRAL
              
                            

Download fasta file
RegulonDB