RegulonDB RegulonDB 10.8: Amino acid Sequence
putative D,D-dipeptide ABC transporter membrane subunit DdpB Amino Acid Sequence


Size: 340

Fasta

 

>putative D,D-dipeptide ABC transporter membrane subunit DdpB E. coli K12. Version NC_000913.3 GI:556503834
MTFWSILRQRCWGLVLVVAGVCVITFIISHLIPGDPARLLAGDRASDAIVENIRQQLGLD
QPLYVQFYRYVSDLFHGDLGTSIRTGRPVLEELRIFFPATLELAFGALLLALLIGIPLGI
LSAVWRNRWLDHLVRIMAITGISTPAFWLGLGVIVLFYGHLQILPGGGRLDDWLDPPTHV
TGFYLLDALLEGNGEVFFNALQHLILPALTLAFVHLGIVARQIRSAMLEQLSEDYIRTAR
ASGLPGWYIVLCYALPNALIPSITVLGLALGDLLYGAVLTETVFAWPGMGAWVVTSIQAL
DFPAVMGFAVVVSFAYVLVNLVVDLLYLWIDPRIGRGGGE
              
                            

Download fasta file
RegulonDB