RegulonDB RegulonDB 10.8: Amino acid Sequence
D-alanyl-D-alanine dipeptidase Amino Acid Sequence


Size: 193

Fasta

 

>D-alanyl-D-alanine dipeptidase E. coli K12. Version NC_000913.3 GI:556503834
MSDTTELVDLAVIFPDLEIELKYACADNITGKAIYQQARCLLHKDAITALAKSISIAQLS
GLQLVIYDAYRPQQAQAMLWQACPDPQYVVDVTVGSNHSRGTAIDLTLRDEHGNILDMGA
GFDEMHERSHAYHPSVPPAAQRNRLLLNAIMTGGGFVGISSEWWHFELPQAASYPLLADQ
FSCFISPGTQHVS
              
                            

Download fasta file
RegulonDB