RegulonDB RegulonDB 10.8: Amino acid Sequence
Autoinducer-2 ABC transporter membrane subunit LsrD Amino Acid Sequence


Size: 330

Fasta

 

>Autoinducer-2 ABC transporter membrane subunit LsrD E. coli K12. Version NC_000913.3 GI:556503834
MRIRYGWELALAALLVIEIVAFGAINPRMLDLNMLLFSTSDFICIGIVALPLTMVIVSGG
IDISFGSTIGLCAIALGVLFQSGVPMPLAILLTLLLGALCGLINAGLIIYTKVNPLVITL
GTLYLFAGSALLLSGMAGATGYEGIGGFPMAFTDFANLDVLGLPVPLIIFLICLLVFWLW
LHKTHAGRNVFLIGQSPRVALYSAIPVNRTLCALYAMTGLASAVAAVLLVSYFGSARSDL
GASFLMPAITAVVLGGANIYGGSGSIIGTAIAVLLVGYLQQGLQMAGVPNQVSSALSGAL
LIVVVVGRSVSLHRQQIKEWLARRANNPLP
              
                            

Download fasta file
RegulonDB