RegulonDB RegulonDB 11.0: Amino acid Sequence
putative diguanylate cyclase DgcF Amino Acid Sequence


Size: 315

Fasta

 

>putative diguanylate cyclase DgcF E. coli K12. Version NC_000913.3 GI:556503834
MLADWFSEQFSTGVLIVPCMLTLAIPGVLPRFKAEQMMPAIALIVSVIASVVIGGAGSLA
FPLPALIWCAVRYTPQVTCLLTFVTGAVEIVLVANSVIDISVGSPFSIPQMFSARLGIAT
MAICPIMVSFSVAAINSLMKQVALRADFDFLTQVYSRSGLYEALKSPSLKQTQHLTVMLL
DIDYFKSINDNYGHECGDKVLSVFARHIQKIVGDKGLVARMGGEEFAVAVPSVNPVDGLL
MAEKIRKGVELQPFTWQQKTLYLTVSIGVGSGRASYLTLTDDFNKLMVEADTCLYRSKKD
GRNRTSTMRYGEEVV
              
                            

Download fasta file
RegulonDB