RegulonDB RegulonDB 10.8: Amino acid Sequence
putative oxidoreductase YnfG Amino Acid Sequence


Size: 205

Fasta

 

>putative oxidoreductase YnfG E. coli K12. Version NC_000913.3 GI:556503834
MTTQYGFFIDSSRCTGCKTCELACKDFKDLGPEVSFRRIYEYAGGDWQEDNGVWHQNVFA
YYLSISCNHCDDPACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNAEK
GHMTKCDGCYSRVAEGKQPICVESCPLRALEFGPIEELRQKHGTLAAVAPLPRAHFTKPN
IVIKPNANSRPTGDTTGYLANPEEV
              
                            

Download fasta file
RegulonDB