RegulonDB RegulonDB 10.8: Amino acid Sequence
DUF1656 domain-containing protein YdhI Amino Acid Sequence


Size: 78

Fasta

 

>DUF1656 domain-containing protein YdhI E. coli K12. Version NC_000913.3 GI:556503834
MKFMLNATGLPLQDLVFGASVYFPPFFKAFAFGFVIWLVVHRLLRGWIYAGDIWHPLLMD
LSLFAICVCLALAILIAW
              
                            

Download fasta file
RegulonDB