RegulonDB RegulonDB 10.8: Amino acid Sequence
putative 4Fe-4S ferredoxin-like protein YdhX Amino Acid Sequence


Size: 222

Fasta

 

>putative 4Fe-4S ferredoxin-like protein YdhX E. coli K12. Version NC_000913.3 GI:556503834
MSFTRRKFVLGMGTVIFFTGSASSLLANTRQEKEVRYAMIHDESRCNGCNICARACRKTN
HVPAQGSRLSIAHIPVTDNDNETQYHFFRQSCQHCEDAPCIDVCPTGASWRDEQGIVRVE
KSQCIGCSYCIGACPYQVRYLNPVTKVADKCDFCAESRLAKGFPPICVSACPEHALIFGR
EDSPEIQAWLQQNKYYQYQLPGAGKPHLYRRFGQHLIKKENV
              
                            

Download fasta file
RegulonDB