RegulonDB RegulonDB 10.8: Amino acid Sequence
putative electron transfer flavoprotein subunit YdiR Amino Acid Sequence


Size: 312

Fasta

 

>putative electron transfer flavoprotein subunit YdiR E. coli K12. Version NC_000913.3 GI:556503834
MSQLNSVWVFSDNPERYAELFGGAQQWGQQVYAIVQNTDQAQAVMPYGPKCLYVLAQNDA
LQRTENYAESIAALLKDKHPAMLLLAATKRGKALAARLSVQLNAALVNDATAVDIVDGHI
CAEHRMYGGLAFAQEKINSPLAIITLAPGVQEPCTSDTSHQCPTETVPYVAPRHEILCRE
RRAKAASSVDLSKAKRVVGVGRGLAAQDDLKMVHELAAVLNAEVGCSRPIAEGENWMERE
RYIGVSGVLLKSDLYLTLGISGQIQHMVGGNGAKVIVAINKDKNAPIFNYADYGLVGDIY
KVVPALISQLSR
              
                            

Download fasta file
RegulonDB