RegulonDB RegulonDB 10.6.3: Amino acid Sequence
putative ABC transporter ATP-binding protein YnjD Amino Acid Sequence


Size: 217

Fasta

 

>putative ABC transporter ATP-binding protein YnjD E. coli K12. Version NC_000913.3 GI:556503834
MLCVKNVSLRLPESRLLTNVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALAEQFSCTGE
LWLNEQRIDILPTAQRQIGILFQDALLFDQFSVGQNLLLALPATLKGNARRNAVNDALER
SGLEGAFHQDPATLSGGQRARVALLRALLAQPKALLLDEPFSRLDVALRDNFRQWVFSEV
RALAIPVVQVTHDLQDVPADSSVLDMAQWSENYNKLR
              
                            

Download fasta file
RegulonDB