RegulonDB RegulonDB 10.8: Amino acid Sequence
DUF1315 domain-containing protein YeaC Amino Acid Sequence


Size: 90

Fasta

 

>DUF1315 domain-containing protein YeaC E. coli K12. Version NC_000913.3 GI:556503834
MNLDDIINSMMPEVYQRLSTAVELGKWPDGVALTEEQKENCLQLVMLWQARHNIEAQHMT
IDTNGQMVMKSKQQLKEDFGISAKPIAMFK
              
                            

Download fasta file
RegulonDB