RegulonDB RegulonDB 10.8: Amino acid Sequence
MltA-interacting protein Amino Acid Sequence


Size: 248

Fasta

 

>MltA-interacting protein E. coli K12. Version NC_000913.3 GI:556503834
MTKLKLLALGVLIATSAGVAHAEGKFSLGAGVGVVEHPYKDYDTDVYPVPVINYEGDNFW
FRGLGGGYYLWNDATDKLSITAYWSPLYFKAKDSGDHQMRHLDDRKSTMMAGLSYAHFTQ
YGYLRTTLAGDTLDNSNGIVWDMAWLYRYTNGGLTVTPGIGVQWNSENQNEYYYGVSRKE
SARSGLRGYNPNDSWSPYLELSASYNFLGDWSVYGTARYTRLSDEVTDSPMVDKSWTGLI
STGITYKF
              
                            

Download fasta file
RegulonDB