RegulonDB RegulonDB 11.1: Amino acid Sequence
DUF1869 domain-containing protein YoaG Amino Acid Sequence


Size: 60

Fasta

 

>DUF1869 domain-containing protein YoaG E. coli K12. Version NC_000913.3 GI:556503834
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW
              
                            

Download fasta file
RegulonDB