RegulonDB RegulonDB 10.8: Amino acid Sequence
DUF1971 domain-containing protein YeaR Amino Acid Sequence


Size: 119

Fasta

 

>DUF1971 domain-containing protein YeaR E. coli K12. Version NC_000913.3 GI:556503834
MLQIPQNYIHTRSTPFWNKQTAPAGIFERHLDKGTRPGVYPRLSVMHGAVKYLGYADEHS
AEPDQVILIEAGQFAVFPPEKWHNIEAMTDDTYFNIDFFVAPEVLMEGAQQRKVIHNGK
              
                            

Download fasta file
RegulonDB