RegulonDB RegulonDB 10.8: Amino acid Sequence
flagellar biosynthesis protein FlhB Amino Acid Sequence


Size: 382

Fasta

 

>flagellar biosynthesis protein FlhB E. coli K12. Version NC_000913.3 GI:556503834
MSDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGML
SAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL
QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT
AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK
GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI
REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLKRWRLAGGQRP
VQPTHLPVPEALDFINEKPTHE
              
                            

Download fasta file
RegulonDB