RegulonDB RegulonDB 10.9: Amino acid Sequence
protein DsrB Amino Acid Sequence


Size: 62

Fasta

 

>protein DsrB E. coli K12. Version NC_000913.3 GI:556503834
MKVNDRVTVKTDGGPRRPGVVLAVEEFSEGTMYLVSLEDYPLGIWFFNEAGHQDGIFVEK
AE
              
                            

Download fasta file
RegulonDB