RegulonDB RegulonDB 10.9: Amino acid Sequence
stress-induced protein Amino Acid Sequence


Size: 75

Fasta

 

>stress-induced protein E. coli K12. Version NC_000913.3 GI:556503834
MKTAKEYSDTAKREVSVDVDALLAAINEISESEVHRSQNDSEHVSVDGREYHTWRELADA
FELDIHDFSVSEVNR
              
                            

Download fasta file
RegulonDB