RegulonDB RegulonDB 10.8: Amino acid Sequence
putative DNA-binding transcriptional regulator YeeY Amino Acid Sequence


Size: 309

Fasta

 

>putative DNA-binding transcriptional regulator YeeY E. coli K12. Version NC_000913.3 GI:556503834
MKPLLDVLMILDALEKEGSFAAASAKLYKTPSALSYTVHKLESDLNIQLLDRSGHRAKFT
RTGKMLLEKGREVLHTVRELEKQAIKLHEGWENELVIGVDDTFPFSLLAPLIEAFYQHHS
VTRLKFINGVLGGSWDALTQGRADIIVGAMHEPPSSSEFGFSRLGDLEQVFAVAPHHPLA
LEEEPLNRRIIKRYRAIVVGDTAQAGASTASQLLDEQEAITVFDFKTKLELQISGLGCGY
LPRYLAQRFLDSGALIEKKVVAQTLFEPVWIGWNEQTAGLASGWWRDEILANSAIAGVYA
KSDDGKSAI
              
                            

Download fasta file
RegulonDB