RegulonDB RegulonDB 10.8: Amino acid Sequence
pyrimidine deoxynucleotide diphosphatase NudI Amino Acid Sequence


Size: 141

Fasta

 

>pyrimidine deoxynucleotide diphosphatase NudI E. coli K12. Version NC_000913.3 GI:556503834
MRQRTIVCPLIQNDGAYLLCKMADDRGVFPGQWAISGGGVEPGERIEEALRREIREELGE
QLLLTEITPWTFSDDIRTKTYADGRKEEIYMIYLIFDCVSANREVKINEEFQDYAWVKPE
DLVHYDLNVATRKTLRLKGLL
              
                            

Download fasta file
RegulonDB